Protein Info for HER17_RS21550 in Pectobacterium carotovorum WPP14

Annotation: D-ribose pyranase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05025: RbsD_FucU
  • amino acids 1 to 138 (138 residues), 156.3 bits, E=3.3e-50

Best Hits

Swiss-Prot: 99% identical to RBSD_PECCP: D-ribose pyranase (rbsD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K06726, D-ribose pyranase [EC: 5.-.-.-] (inferred from 97% identity to eca:ECA0010)

MetaCyc: 69% identical to D-ribose pyranase (Escherichia coli K-12 substr. MG1655)
RXN0-5304 [EC: 5.4.99.62]

Predicted SEED Role

"Ribose ABC transport system, high affinity permease RbsD (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

MetaCyc Pathways

• ribose phosphorylation (2/2 steps found)

KEGG Metabolic Maps

• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.- or 5.4.99.62

Protein Sequence (139 amino acids)

>HER17_RS21550 D-ribose pyranase (Pectobacterium carotovorum WPP14)
MKKAALLNSDISSVISRLGHTDSLVIGDAGLPIPETTTRIDLALTHNVPTFLQVVSVVTS
EMQVEAAILAEEIIEKNPAVHDALLDQLKQLEQHQGNSIALHYVSHEEFKTQSGKSRAII
RSGECSPYANVILCAGVTF