Protein Info for HER17_RS21540 in Pectobacterium carotovorum WPP14

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 314 (270 residues), 150 bits, see alignment E=3.8e-48

Best Hits

Swiss-Prot: 88% identical to RBSC_ECOLI: Ribose import permease protein RbsC (rbsC) from Escherichia coli (strain K12)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 99% identity to eca:ECA0012)

MetaCyc: 88% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>HER17_RS21540 ribose ABC transporter permease (Pectobacterium carotovorum WPP14)
MSSQSIAAKRWFSKEWLLEQKSLIALLILIAVVSAMSPNFFTLNNLFNILQQTSVNAIMA
VGMTLVILTSGIDLSVGSLLALTGAVAASIVGLEVNALVAVFGALALGALIGAGTGVIVS
KGKVQAFIATLVMMLLLRGVTMVYTNGSPVNTGFSDVADAFGWFGIGRPLGIPTPIWIMA
IVFAAAWYMLHHTRLGRYIYALGGNESATRLSGISVDRVKIIVYSLCGLLSALAGIIEVA
RLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIVGTLIGALILGFLNNGLNLLGVSSY
YQMIVKAVVILLAVLVDNKSSK