Protein Info for HER17_RS21305 in Pectobacterium carotovorum WPP14

Annotation: 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF04445: SAM_MT" amino acids 19 to 246 (228 residues), 357.3 bits, see alignment E=1.6e-111

Best Hits

Swiss-Prot: 98% identical to RSMJ_PECAS: Ribosomal RNA small subunit methyltransferase J (rsmJ) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 98% identity to pct:PC1_4197)

MetaCyc: 80% identical to 16S rRNA m2G1516 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6731 [EC: 2.1.1.242]

Predicted SEED Role

"rRNA small subunit methyltransferase J"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.242

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>HER17_RS21305 16S rRNA (guanine(1516)-N(2))-methyltransferase RsmJ (Pectobacterium carotovorum WPP14)
MSICLIAEEGADSGALSSLAARWGLVSDPDAVMALVLTAERLELRKQDEPKLGAIFVDFV
AGTMAHRRRFGGGRGEAVAKAVGIKKDYLPDVVDATAGLGRDAFVLAALGCHVRMVERNP
VVAALLDDGLQRGYQDAEIGPWLRERLTLLHASSMTALRDITPPPDVVYLDPMFPHKQKS
ALVKKEMRVFQSLVGADDDADALLEPARALAKKRVVVKRPDYAPPLAGVPAQSMLETKSH
RFDFYLPV