Protein Info for HER17_RS21295 in Pectobacterium carotovorum WPP14

Annotation: TonB-dependent hemoglobin/transferrin/lactoferrin family receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 849 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 149 to 847 (699 residues), 395.7 bits, see alignment E=4.1e-122 TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 149 to 848 (700 residues), 479.9 bits, see alignment E=1.4e-147 PF07715: Plug" amino acids 152 to 254 (103 residues), 65.4 bits, see alignment E=6.3e-22 PF00593: TonB_dep_Rec" amino acids 353 to 821 (469 residues), 156.6 bits, see alignment E=2e-49

Best Hits

Swiss-Prot: 49% identical to TDHA_HAEIN: TonB-dependent heme receptor A (tdhA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 96% identity to eca:ECA0056)

Predicted SEED Role

"Putative Ton-B dependent hemine receptor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (849 amino acids)

>HER17_RS21295 TonB-dependent hemoglobin/transferrin/lactoferrin family receptor (Pectobacterium carotovorum WPP14)
MAINNHNGGRIVHKPALTVARAVHLALSGVLILSAGAASPALAAETAAATTAPTITFSIP
AGSLGTTLQAIASRANVILTFSPDQTQNKTSGNVQGTYTVQAAFAAALAGTGMSALQTAT
GYRLESALAAEGSDGSLMIPTLSVVGGTSDSAAAGRSVLRQADVDRVQADNIASLLDKLP
GVSMAGSPRPGGQSLNIWGMGDMEDVKVVLDGAPKGFEKYRQGSVFIEPELIKRIDVDKG
PHDIRSGNGGFGGTIHVDTKDASDLLLPGENFGGMVKYSYHTNDRQNIYSGALYGRTEEG
MADGLLYMSKRDGDNIERPDGTRFVYSTSDMASYLLKTNIYLTDAQTLTLSAMRSESDGW
QPFAAKRDDMAAPTQAEITRYGWEEAWRRKLVYRDQVDKNYSLKWNIAPEDQPWLNLTAS
FATSKTEQHDRRPDSASQSSYLGTLGNESWVSYKDQLAEVSNESQFTTGPFDHKLLVGMR
WHQHKRDTLIYYPSGKNSAEYNYGYFQPYYMPAGEQETRSLYVQDAVTLGSVTITPGVRY
DHVTNTGKPNAAPRYNSSIPAAGHDYSSVTYTGWSPRIGALWKATDNLSLFADASRTWRA
PVVDEQYEVQSAASSVPGTSRNLEVESIKAFRLGAILDFNNLMLEEDSLQIRTTLFRNRG
KNEIFYRRGILCEAQTQSGTSSSCGQPLSNYRNMPGYTIEGVEIESFYDSRWLFGSLSFS
SIRGERDASPRNPWGNKTWIAEIPPTTAHATLGTKIPRLDMAVGWTGDFVRKQDRSPADG
DPQADIWALPKSKGYVLHGLFASWQPQTIKGFEARVTVDNLLNTDYYPYLGESVSGVGRN
VKISVLQRF