Protein Info for HER17_RS20995 in Pectobacterium carotovorum WPP14

Annotation: sterol desaturase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 78 to 211 (134 residues), 98 bits, see alignment E=3e-32

Best Hits

KEGG orthology group: None (inferred from 95% identity to pwa:Pecwa_4418)

Predicted SEED Role

"C-5 sterol desaturase (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>HER17_RS20995 sterol desaturase family protein (Pectobacterium carotovorum WPP14)
MIDLALPIVFMLVVVIGEALVLQWMQRETVNWHDVVFNLNSGHIMLWLFRSVEIFCYGYV
AAHFSLGWVETWPPVLMWLFAILAWDFGFYWLHRLHHTFGVLWAVHVVHHQGEHFNLSLG
VRNSWYSSLTSIPFFLILALLGVPLYVFVTVSILHYSVQLFNHNAMTPKLGWLEKVLVTP
AHHRVHHVNDRAYADKNFGGTFIFWDKLFGSFCPQLPDTPFRYGAGREIPSKNPFWASNL
PFLSYLKLSVRRTRQATFHCTPMALIAGAMLLFALVVGYVYLYGYGYDSANLSQAALFLL
LVAGAVALGGISEGRRWGIYVWLLVGLLFPSVFLVYLGWEALYWKMAMLMLALHGLAMAV
GWGRCPLTEEHENV