Protein Info for HER17_RS20985 in Pectobacterium carotovorum WPP14

Annotation: acyl-CoA desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 235 to 259 (25 residues), see Phobius details PF00487: FA_desaturase" amino acids 75 to 341 (267 residues), 92.9 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: None (inferred from 94% identity to pct:PC1_4135)

Predicted SEED Role

"Linoleoyl-CoA desaturase (EC 1.14.19.3)" (EC 1.14.19.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.19.3

Use Curated BLAST to search for 1.14.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>HER17_RS20985 acyl-CoA desaturase (Pectobacterium carotovorum WPP14)
MLAPLKPLRYEQGRDLALHRALMKAANDYLAAAGDHRFANAGFIGKMLFLVALCLTFYGF
SLWQTTLWGFAGCYFGFIFTAMFLAVNVVHDASHNVFFRRPWANRLLNIVVSIPLGMDSD
CWRVRHVIFHHAHVNVQHYDLDIEENGVLRQSPYHRFRFFMRAQRYYWPMVASLTFPCII
WFFDWLDRAGKTQVTRNMTLQGGKGWGIFLLSKALHALLALAIPYWLLSPTPVSAGALLL
VYLLSQMLSSLIFVVLILGSHWAKGTFYQAPEDGLFRHGRYQHVFSTTVDWTTRPIWLGY
WLGQLNMHLTHHIFPNWNHRHYPALSKIIAEVAPRYGIDYQCITLKAILVEQQRFLKKMG
NGSKK