Protein Info for HER17_RS20505 in Pectobacterium carotovorum WPP14

Annotation: UDP-N-acetylmuramate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 8 to 332 (325 residues), 360.5 bits, E=3.1e-112
• PF01565: FAD_binding_4
  • amino acids 22 to 152 (131 residues), 79.9 bits, E=1.5e-26
• PF02873: MurB_C
  • amino acids 209 to 332 (124 residues), 110.7 bits, E=3.5e-36

Best Hits

Swiss-Prot: 89% identical to MURB_PECAS: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 95% identity to pct:PC1_0194)

MetaCyc: 64% identical to UDP-N-acetylenolpyruvoylglucosamine reductase (Escherichia coli K-12 substr. MG1655)
UDPNACETYLMURAMATEDEHYDROG-RXN [EC: 1.3.1.98]

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• peptidoglycan recycling I (13/14 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158 or 1.3.1.98

Protein Sequence (345 amino acids)

>HER17_RS20505 UDP-N-acetylmuramate dehydrogenase (Pectobacterium carotovorum WPP14)
MASSVISLKSYNSFSLPVSASCIKVADTQEKLIEGWHVASASQEPILLLGEGSNVLFLED
FLGTILLNRLKGIDIREERYGWYLHVGAGENWHQLVEYTLKRGIAGLENLALIPGCVGSA
PIQNIGAYGIELQHVCDYVDVLDLAEGKVMRFTSEECQFDYRESIFKHQYRSGFAIIAVG
FFLKKEWNPILNYGDLVKLDPTTVTPQQVFDSVCHMRRSKLPDPVVTGNAGSFFKNPIIT
QQHAERILREYPNAPQYLQTDGNVKLAAGWLIDQCKLKGFQLGGAAVHEKQALVLINKNN
AKSSDIVELARYVRNQVSEKFSIQLEPEVRFIAAHGEVNAIEVLS