Protein Info for HER17_RS20405 in Pectobacterium carotovorum WPP14

Annotation: 2-iminoacetate synthase ThiH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR02351: thiazole biosynthesis protein ThiH" amino acids 5 to 368 (364 residues), 525.3 bits, see alignment E=3.9e-162 PF04055: Radical_SAM" amino acids 82 to 228 (147 residues), 46 bits, see alignment E=6.7e-16 PF06968: BATS" amino acids 259 to 361 (103 residues), 50.1 bits, see alignment E=2.6e-17

Best Hits

Swiss-Prot: 81% identical to THIH_SALTY: 2-iminoacetate synthase (thiH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03150, thiamine biosynthesis ThiH (inferred from 97% identity to pct:PC1_0211)

MetaCyc: 82% identical to 2-iminoacetate synthase (Escherichia coli K-12 substr. MG1655)
RXN-11319 [EC: 4.1.99.19]

Predicted SEED Role

"2-iminoacetate synthase (ThiH) (EC 4.1.99.19)" (EC 4.1.99.19)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>HER17_RS20405 2-iminoacetate synthase ThiH (Pectobacterium carotovorum WPP14)
MNVDFQTVWEQLDWDDLTLRINGKTAHDVERALAAPHLTRDDFMALISPAASAYLEPLAQ
RAQQLTRQRFGNTVSFYVPLYLSNLCSNDCTYCGFSMSNHIKRKTLDEAEILRECAAIKE
LGFEHLLLVTGEHQRKVGMDYFRRVFPLIRPLFSSLMIEVQPLSQDEYAELKTLGLDGVM
VYQETYHPATYQLHHLKGQKQDFHWRLATPDRLGRAGIDKIGLGALIGLSNSWRTDCYIV
AEHLLHLQQNYWQSRYSISFPRLRPCTGGIEPASLMDEAQLMQVICAFRLLSPDIELSLS
TRESPFFRDHAIPIAINNVSAFSKTQPGGYADDHPELEQFSPHDSRRPEDVAQAIIRAGL
QPVWKDWDGYLGR