Protein Info for HER17_RS20210 in Pectobacterium carotovorum WPP14

Annotation: TOBE domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 TIGR00638: molybdenum-pterin binding domain" amino acids 1 to 68 (68 residues), 69.1 bits, see alignment E=1.3e-23 amino acids 75 to 140 (66 residues), 73.6 bits, see alignment E=5e-25 PF03459: TOBE" amino acids 4 to 66 (63 residues), 52.9 bits, see alignment E=1.7e-18 amino acids 76 to 138 (63 residues), 52.5 bits, see alignment E=2.3e-18

Best Hits

KEGG orthology group: None (inferred from 96% identity to pct:PC1_0242)

Predicted SEED Role

"Molybdate-binding domain of ModE" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>HER17_RS20210 TOBE domain-containing protein (Pectobacterium carotovorum WPP14)
MSVSARNQLSGVVSSIVEGAVNNEVALTLESGDKLTTVITRTSCDSMELAVGKPAIALVK
APWVILASAECGLNFSARNQFHGKVSTVAKGAVNSTVQLVTAGGLTLTSTVTNESLEEMN
IDVGSELIALVKASSIILATRK