Protein Info for HER17_RS20025 in Pectobacterium carotovorum WPP14

Annotation: phospholipid ABC transporter ATP-binding protein MlaF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 25 to 172 (148 residues), 105.1 bits, E=4.8e-34

Best Hits

Swiss-Prot: 76% identical to MLAF_ECOLI: Intermembrane phospholipid transport system ATP-binding protein MlaF (mlaF) from Escherichia coli (strain K12)

KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 97% identity to pwa:Pecwa_0288)

Predicted SEED Role

"Uncharacterized ABC transporter, ATP-binding protein YrbF"

Protein Sequence (270 amino acids)

>HER17_RS20025 phospholipid ABC transporter ATP-binding protein MlaF (Pectobacterium carotovorum WPP14)
MNHEATNLVEIRGLSFRRGEREIFTDITLNVPKGKVTAIMGPSGIGKTTLLRLIGGQLPP
DSGEIWFDGENIPTLSRSELYNARKKMSMLFQSGALFTDLNVFDNVAWPLREHTKLPEAL
LRSIVMMKLEAVGLRGAAELMPAELSGGMARRAALARAIALDPQLIMFDEPFVGQDPITL
GTLVKLIDELNHALGVTCIVVSHDVPEVMSIADYAYIVADKRVIGEGTADQLRANNDPQV
RQFLDGIADGPVPFRFPAGDYKTSLLGSGG