Protein Info for HER17_RS19830 in Pectobacterium carotovorum WPP14

Annotation: DUF1190 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF06693: DUF1190" amino acids 42 to 208 (167 residues), 185 bits, see alignment E=6.5e-59

Best Hits

Swiss-Prot: 99% identical to Y312_PECCP: UPF0441 protein PC1_0312 (PC1_0312) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: None (inferred from 98% identity to eca:ECA0329)

Predicted SEED Role

"UPF0441 protein ygiB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>HER17_RS19830 DUF1190 family protein (Pectobacterium carotovorum WPP14)
MKRTKNINQETFRKEWRTHRLAPVALAVSAVFFLAGCEQTDETVSLYQNADDCSSANPSM
AAQCTTAYNNALKEAEKTAPKYATKEDCVAEFGEAQCTQTPAPAQAGMAAESQQGGGMSW
MPLMAGYMMGRMMGGGAGFAQQPLFSPKTPASPANGQFVDAAGKNYGNATTGRSMTVPKT
ALAPKPATTSTITRGGFGETVAKQNSMQRSSASSSSSSSRSMGG