Protein Info for HER17_RS19705 in Pectobacterium carotovorum WPP14

Annotation: NADPH-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00881: Nitroreductase" amino acids 10 to 164 (155 residues), 73.2 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 46% identical to NFRA2_BACSU: FMN reductase [NAD(P)H] (nfrA2) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to pct:PC1_0338)

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>HER17_RS19705 NADPH-dependent oxidoreductase (Pectobacterium carotovorum WPP14)
MNKTIELFTSHRSERSYLDKAIPDDVLDAIIQSAHLAPTSVNSQQVSLIVTRDPERKARI
AELAGGQPWIAQAPVFITVVLDMHKTQVGIAMSDKQQHAHESLESLISGTTDVGIALGTL
MAAARSFGLGIVPIGGIRRDPQAMIDFLELPELTFPVAGVAIGYVDTPAHQKPRLPLNSF
RHDETYHQDVLPAAIEQYNQTLVAHWQQAGRADGDNWGDNTASYYQHIYFPKVLPAILQQ
GFKLDK