Protein Info for HER17_RS19680 in Pectobacterium carotovorum WPP14

Annotation: TRAP transporter small permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details PF04290: DctQ" amino acids 27 to 153 (127 residues), 85 bits, see alignment E=2.2e-28

Best Hits

KEGG orthology group: None (inferred from 96% identity to pct:PC1_0343)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>HER17_RS19680 TRAP transporter small permease (Pectobacterium carotovorum WPP14)
MAQSYLSSMDVLYRIAMWVSGLALLIMTLVIPVGIFARYVLNAALSWPEPISIICMVTFT
FVGAAVSYRSNSHIAVSMLTDRLPETGKKVCVHLANLLMLLISLFILYYSTVLCMELWEQ
PVAEFPLLTAGESYLPLPIGSFITVLFIIEKMFFGPQDKRPVVMLGSS