Protein Info for HER17_RS19655 in Pectobacterium carotovorum WPP14

Annotation: sucrose-6-phosphate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 TIGR01322: sucrose-6-phosphate hydrolase" amino acids 18 to 442 (425 residues), 530.3 bits, see alignment E=1.9e-163 PF00251: Glyco_hydro_32N" amino acids 31 to 336 (306 residues), 353.7 bits, see alignment E=1.1e-109 PF08244: Glyco_hydro_32C" amino acids 361 to 447 (87 residues), 41 bits, see alignment E=2e-14

Best Hits

KEGG orthology group: K01193, beta-fructofuranosidase [EC: 3.2.1.26] (inferred from 96% identity to pct:PC1_0348)

Predicted SEED Role

"Sucrose-6-phosphate hydrolase (EC 3.2.1.B3)" (EC 3.2.1.B3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.26 or 3.2.1.B3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>HER17_RS19655 sucrose-6-phosphate hydrolase (Pectobacterium carotovorum WPP14)
MKEVHLLKRMAHALMSGHSRKQEDPYRPEWHLSPSVGLLNDPNGFIHHNGRYHLFYQWNP
LSCAHGAKFWGHWSSVDLVNWMHEPVALVPSESYESHGCYSGSAVADQGAIMLVYTGNVK
YDDGSRTAFQCLARENPNGEYDKLGAVLTLPDGYTGHVRDPKVWRQDDHWYMVLGAQDLD
LQGKVLLYRSADLLAWEKIGEIAGSRLGGLGDFGYMWECPDLFPLDGKDVLICCPQGVPA
EEERYLNTFQAGYFIGSLNYENGTYPHQDFHELDLGFEFYAPQTTLSEDGRRLLFGWMSI
PDDNEFFEPTIEQGWIHTMTCPRELTLHGDRVYQRPARELQQLRRQHYTWHGAADYASPL
HASSAEILITVQGEFQFNLASQLVLCWDGERVTLSRRNRRTGEPEHRYWRGDLSQLQILC
DRSSVEIFINDGEAVMSARYFPESEATMTFSGSGRLTLQHWLLAPCVIE