Protein Info for HER17_RS19470 in Pectobacterium carotovorum WPP14

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 193 to 213 (21 residues), see Phobius details PF02203: TarH" amino acids 1 to 174 (174 residues), 104.7 bits, see alignment E=1.1e-33 PF12729: 4HB_MCP_1" amino acids 4 to 184 (181 residues), 37.1 bits, see alignment E=5e-13 PF00672: HAMP" amino acids 212 to 262 (51 residues), 40.8 bits, see alignment 4.6e-14 PF00015: MCPsignal" amino acids 325 to 482 (158 residues), 177.6 bits, see alignment E=4.1e-56

Best Hits

KEGG orthology group: None (inferred from 98% identity to pct:PC1_0380)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>HER17_RS19470 methyl-accepting chemotaxis protein (Pectobacterium carotovorum WPP14)
MFRKIKIRTALSMMVFSLAALLLFVGVLGLVAVQSGNKSFARVDMEVLPGLVALNDSSEL
LLRGRLDLRLYESLMGKGDVEAAKVALGRARGKVDGASEKWQEYLKYPQSEAEKVISADM
AEKRNTLMQEFIDPAFAALNAGNLDEYRQRAGKSTVLYAAFDKSSKALVAFKLKSIDEAY
ADSNGRVELMETILYGAIACALLLAALAWSVVTNMIVKPLNQAISVFDRIAEGDLRAQID
SSGKNEIAHLFAAVQRMRDGLENMVRVVRNGTDAISVGVEEIASGNIDLSSRTEQQAASL
DETASSMEQIMSTVKNNEDNTRKANDLALKASNSASRGGNVVSEVVDTMRSIKQSSAKIS
DIVGVIDGIAFQTNLLALNAAVESARAGQYGKGFAVVASEVRMLAARSATAAKEIGTMID
DSLSRIEKGAGLVEVAGNTMDEVLMDVKKVVDIMDEITLASSEQSRGISQINIAINQMDG
VTQQNASLVSEVATSANSLQEQVINLQQSVSRFQIARENMELGNVLPGLRQNIALADAR