Protein Info for HER17_RS19325 in Pectobacterium carotovorum WPP14

Annotation: RNA repair transcriptional activator RtcR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 PF06956: RtcR" amino acids 2 to 185 (184 residues), 279.6 bits, see alignment E=2.6e-87 PF00158: Sigma54_activat" amino acids 188 to 354 (167 residues), 168.9 bits, see alignment E=2.5e-53 PF14532: Sigma54_activ_2" amino acids 193 to 355 (163 residues), 49.6 bits, see alignment E=1.6e-16 PF01078: Mg_chelatase" amino acids 204 to 311 (108 residues), 23.1 bits, see alignment E=1.4e-08 PF00004: AAA" amino acids 211 to 332 (122 residues), 25.5 bits, see alignment E=4.9e-09 PF07728: AAA_5" amino acids 211 to 333 (123 residues), 29.7 bits, see alignment E=1.7e-10

Best Hits

Swiss-Prot: 61% identical to RTCR_ECOLI: Transcriptional regulatory protein RtcR (rtcR) from Escherichia coli (strain K12)

KEGG orthology group: K14414, transcriptional regulatory protein RtcR (inferred from 95% identity to pct:PC1_0403)

Predicted SEED Role

"Transcriptional regulatory protein RtcR" in subsystem RNA 3'-terminal phosphate cyclase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>HER17_RS19325 RNA repair transcriptional activator RtcR (Pectobacterium carotovorum WPP14)
MKRRVVIGVLGTTLDKRGKRENRWTKWRPTVGLCQQPDFPVDRLELLHQSRNEGMAQQVA
EDIAVVSPATRVTLQAVELRDPWNLEEVYSAFLDFASRYPFDTENEEYFVHITTGTHVVQ
ICWFLLTEARYLPAKLLQTAPGEKADRPAPKGIYAVIDLDLSRYATLTSRFQHEQERSIS
FLKSGIETRNATFNALIDQIERVALRSTAPMLLTGPTGAGKSFLAQRIYQLRQSRHLVSG
RFVAVNCATLRGDNAMSTLFGHVKGAFTGALQARAGLLREADGGMLFLDEIAELGLDEQA
MLLKAIEEKRFLPFGSDKEVNSDFQLIAGTHRNLREWIAQGKFREDLYARINMWTFPLLG
LAERREDIEPNIEYELQRFTRDHQTQIRFDKDARQHYLTFACSPQAAWRGNFRELGSSIA
RMATLAEQGRITVALVEEEVARLRANWQSDSPATALSPALPPELANIDLFEQHQLETVLD
VCRTSNSLSEAGRRLFAVSRQQKQKPNDADRLRKYLARFGLSWEGLKRESE