Protein Info for HER17_RS19090 in Pectobacterium carotovorum WPP14

Annotation: multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 PF01381: HTH_3" amino acids 7 to 58 (52 residues), 29.3 bits, see alignment 1.1e-10 TIGR01526: nicotinamide-nucleotide adenylyltransferase" amino acids 64 to 395 (332 residues), 517.6 bits, see alignment E=1.3e-159 TIGR00125: cytidyltransferase-like domain" amino acids 66 to 136 (71 residues), 66.6 bits, see alignment E=1.7e-22 PF01467: CTP_transf_like" amino acids 69 to 213 (145 residues), 27.4 bits, see alignment E=5.3e-10 PF13521: AAA_28" amino acids 234 to 394 (161 residues), 111 bits, see alignment E=1.1e-35

Best Hits

Swiss-Prot: 86% identical to NADR_SALTY: Trifunctional NAD biosynthesis/regulator protein NadR (nadR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06211, HipB family transcriptional regulator, involved in the regulation of NAD biosynthesis (inferred from 98% identity to pct:PC1_0448)

MetaCyc: 84% identical to DNA-binding transcriptional repressor/NMN adenylyltransferase NadR (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide adenylyltransferase. [EC: 2.7.7.1]; Ribosylnicotinamide kinase. [EC: 2.7.7.1, 2.7.1.22]

Predicted SEED Role

"NadR transcriptional regulator / Nicotinamide-nucleotide adenylyltransferase, NadR family (EC 2.7.7.1) / Ribosylnicotinamide kinase (EC 2.7.1.22)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters (EC 2.7.1.22, EC 2.7.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.22 or 2.7.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>HER17_RS19090 multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR (Pectobacterium carotovorum WPP14)
MSSFDYLKSAIRQKGCTLQQVADATDMTKGYLSQLLNAKIKSPSAQKLEALHRFLELEFP
RYEKSIGVVFGKFYPLHTGHIYLIQRACSQVDELHVILGYDEPRDRLLFENSSMSQQPTV
SDRLRWLLQTFKYQKNIHIHAFNEQGMEPYPHGWDVWSKGIQAFMQEKSITPNFVYTSEE
QDAAQYREQLGIESVLIDPQRSFMNISGSQIRHDPFRYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGQAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
STTARSEFQDLLKTMLANNNIPYVYIKESDYDSRFLHCVELVQQMLGHDRSPEALKS