Protein Info for HER17_RS18630 in Pectobacterium carotovorum WPP14

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 transmembrane" amino acids 19 to 35 (17 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 16 to 342 (327 residues), 101.6 bits, see alignment E=4.7e-33 PF19040: SGNH" amino acids 430 to 645 (216 residues), 82.8 bits, see alignment E=3.2e-27

Best Hits

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (663 amino acids)

>HER17_RS18630 acyltransferase (Pectobacterium carotovorum WPP14)
MTTSNPHLSHPKYRPDIDGLRAVAVLSVVAFHAFPDWMKGGFIGVDIFFVISGFLISTII
FENLDKGTFSFSEFYARRIKRIYPALLLVLTVSIVFGWFALLADEYKQLGKHTMAGVGFV
SNLVLWGESGYFDNAAETKPLLHLWSLGIEEQFYFLWPLLCWLFWRMNFRRIALLLTFIV
ASFVLNIYMIRSDGVATFYSPLTRFWELLFGSLLAFIVLYHKSFIDKFQKNQFVINGFSL
FGFLILGFGFLSINKDAYFPGFWALIPVIGAVLIIFAGPNAILNRLFLSNKIVVWFGLIS
FPLYLWHWPLLTFLRIVERGTPDRFLRLAAVFLSILLAWFTYKFVEGKIRKSKGYKFVGT
LVLLSVVLFVSGSVVFYKDGFSERKAVTTSEFTKEVQYQFMGPIWAYTKNDTCLSEYPYK
DQNNLAWWFCMKSGTKPPTILLLGNSYANQLYPGFAKNEKLKHQTILSIGTCGVGFDNSG
DDPRSPCYGSRITDQAKFIDDIIKRTPSIKFVILDGLSRQPSSDEITRVIQRIDFLEKQG
VKVIIFTPHIRPGFHPKACFKSPLKQHPKDCLVSSDVRSSILKDFNPLLVAVNKTHPGVL
VFEQNDVFCDRKDGKCSYVKNGLPLYRDEGHTSEYASLLLQDYFTKWASSHVPSILDSAP
ADN