Protein Info for HER17_RS18115 in Pectobacterium carotovorum WPP14

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 24 to 274 (251 residues), 157.3 bits, see alignment E=8.1e-50 PF05992: SbmA_BacA" amino acids 29 to 340 (312 residues), 104.3 bits, see alignment E=1.4e-33 PF00005: ABC_tran" amino acids 374 to 505 (132 residues), 69 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 91% identity to pct:PC1_0603)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>HER17_RS18115 ATP-binding cassette domain-containing protein (Pectobacterium carotovorum WPP14)
MQTLKRFYALVAPFWLTTRATLLWLLLLLIMSLTLSVVWISVQYNNWSRDFYDALADYFQ
HASIYDMAVRYLAYTLLFVLVIICGNWLKKQLIIRWRDTMTHQYEQDWLSNHAHYQLSSG
LDNPDQRIAEDIRLLIEQSLELLLSLLKNTARFFSFIAILWQLSGVHTFTLAGYTITVHG
YLVWIALVYAAVASVVTHLLGHRLHKLNIERQRAEADYRATLLRVRDNSEQIAFYQGSDT
EQQRMRQHFQPIVQNWQRLMTREFRLESFTTSYFRFSLIIPVFATLPLFLARQVSLGAIM
QARSAFGYVLDAFGWFIDAYRQLVQWSSTIERLWEFQHRLQQLPTPEEPRHEGYALHINA
LSVSRPEGSPYFSPLTLTLQAGEWAVLSAVSGSGKTTLLRALAGLWPTSQGERHFPAGRA
LFLPQKAYLPQDTLRQVLCYPQAQLADTARLIAVLEQTGLAALIPRLDDKANWGRELSGG
EQQRLSLARALLLRPTLLCLDEATSQLDDAAALQLLEHIRTTLPQTIVLAVSHQPAVLAC
FKHQIRLTPLEPEKKAHTENRIVDPSVAPPAADVQQVAYGRI