Protein Info for HER17_RS17975 in Pectobacterium carotovorum WPP14

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 115 to 285 (171 residues), 59 bits, see alignment E=2.7e-20

Best Hits

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 93% identity to eca:ECA0749)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>HER17_RS17975 carbohydrate ABC transporter permease (Pectobacterium carotovorum WPP14)
MNVENPSVDHPNVENLSVNVRHVANRHPLRVTTRFTLPLLLICAALLWVSPFIWMLSASV
STSSFGVDMASLLPRLPLTFDNFRDAWDSADWLRLYTNTLIFAVGTFLVQLVTITTAGYI
FAYHEFRGKTLLFYLLLIQMMIMPVVMMVPNMMTLKQLGLLNTLTGVMMPYFASAFGVFL
MRQAFLNIAKEIEEAALMEGCRWWQVVFHVLIPMTWPSILAFATVSITYHWNEYLWPLMV
LNDPDKQVLTIGLVSFAMGAESGGQWGLICAGTLLVCLPLMVAFVVFQKQFLSSFGFSGI
K