Protein Info for HER17_RS17965 in Pectobacterium carotovorum WPP14

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00005: ABC_tran" amino acids 21 to 161 (141 residues), 118.6 bits, see alignment E=6.5e-38 PF17912: OB_MalK" amino acids 235 to 281 (47 residues), 30.3 bits, see alignment 1.3e-10 PF08402: TOBE_2" amino acids 274 to 347 (74 residues), 53.9 bits, see alignment E=3.2e-18

Best Hits

Swiss-Prot: 48% identical to UGPC_PARDP: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: None (inferred from 96% identity to eca:ECA0751)

MetaCyc: 47% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter ATP-binding subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Probable sugar ABC transporter, ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>HER17_RS17965 ABC transporter ATP-binding protein (Pectobacterium carotovorum WPP14)
MAVIQLRNISKRFEHMQALASLSLDIADGEFLVLVGPSGCGKSTLLRMLAGLEDVSDGQI
LLGDDDITTWSPKQRNFSMIFQNYALFPHLTVEQNITFGMRMRGEPKADYPQRVQRVACL
LQLEPLLKRKPGKLSGGQRQRVAMARAIVRDPRLFLMDEPLSNLDARLRSDVRDGIMDLH
RQLKTTTVYVTHDQIEAMTMADRIAVLDRGVLQQVGTPEQLYSHPANVFVAGFIGTPAMN
LVTLSCTDGHALLQALPVALPASEETRSLTSVLLGIRPEHITEHAASDGELSLSGIVKQR
ELFGAEYLIHVDTPLGNIRYRRPNRDGVPDVGASIVLHFSPQDCHWFSGQTARNLSQEKR
NA