Protein Info for HER17_RS17935 in Pectobacterium carotovorum WPP14

Annotation: hemolysin III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details PF03006: HlyIII" amino acids 11 to 208 (198 residues), 133.4 bits, see alignment E=5.2e-43 TIGR01065: channel protein, hemolysin III family" amino acids 14 to 215 (202 residues), 240 bits, see alignment E=9e-76

Best Hits

Swiss-Prot: 85% identical to YQFA_ECOLI: UPF0073 inner membrane protein YqfA (yqfA) from Escherichia coli (strain K12)

KEGG orthology group: K11068, hemolysin III (inferred from 97% identity to pwa:Pecwa_0850)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>HER17_RS17935 hemolysin III family protein (Pectobacterium carotovorum WPP14)
MSKNEQMSDYSLAEEIANSISHGIGVILGIVGLVLLLVQAVNNDAGSVAITSYSLYGGSI
ILLFLASTLYHAIPSQRIKPWLKKFDHCAIYLLIAGTYTPFLLVGLDSPLAHGLMVVIWS
MALLGVIFKLAFAHRFEVLSLITYLVMGWLSLVVIYQMVMKLAAGSVTLLAVGGVVYTLG
VIFYACKRIPYNHAIWHGFVLGGSVCHFLAIYLYI