Protein Info for HER17_RS17845 in Pectobacterium carotovorum WPP14

Annotation: LysE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 38 to 65 (28 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details PF01810: LysE" amino acids 14 to 214 (201 residues), 98 bits, see alignment E=2.6e-32

Best Hits

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 97% identity to pct:PC1_0651)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>HER17_RS17845 LysE family transporter (Pectobacterium carotovorum WPP14)
MLLVVFTGMLLSLSLCLDLGMVNTAIINRGLRHGARSAFYIGLGSCFGDLFYATLSVLGL
AVVFNLTPVRWVLWIGGGLILIWMTFSMARAAWRDYQVKRFADLSATANAADFTVPPARY
TEFLSGVGMALASPTALLWFAAIGGTIIAQSTDGSAFMITLFLLGFFVGGVLWTFFLAAL
VKYGQRLLKERISFYCSLISALLFAYFAWHVISNGYETLFLPLSTTV