Protein Info for HER17_RS17755 in Pectobacterium carotovorum WPP14

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 335 to 360 (26 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details amino acids 390 to 419 (30 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 28 to 411 (384 residues), 280.5 bits, see alignment E=9.2e-88

Best Hits

Swiss-Prot: 86% identical to GHXQ_ECOLI: Guanine/hypoxanthine permease GhxQ (ghxQ) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 98% identity to eca:ECA0783)

MetaCyc: 86% identical to guanine/hypoxanthine transporter GhxQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-562; TRANS-RXN0-578

Predicted SEED Role

"Guanine-hypoxanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>HER17_RS17755 NCS2 family permease (Pectobacterium carotovorum WPP14)
MSNTTRQAGSQGPLDAFFKITQRGSNVRQEVLAGLTTFLAMVYSVIVVPSMLGKAGFPPT
AVFVATCLVAGLGSLLMGLWANLPMAIGCAISLTAFTAFSLVLGQQISIPVALGAIFLMG
VLFTIISVTGIRSWILRNLPMGVAHGTGIGIGLFLLIIAANGVGLVVKNPIDGLPVALGN
FTSFPVIMSLLGLAATIGLEKRRVPGGILLVIIAISILGLIFDPNVKYAGFFALPSLTAA
DGSSLIFSLDIMGALQPMVLPSVLALVMTAVFDATGTIRAVAGQANLLDKDGQIINGGKA
LTADSVSSIFSSLVGTSPAAVYIESAAGTAAGGKTGLTATVVGVLFLLLLFVSPLAYLVP
GYATAPALMYVGLLMLGNVSKLNFDDFVDAMSGLVCAVFIVLTCNIVTGIMLGFGALVLG
RIFSGEWRKLNIGTVVIAVALVVFYAGGWAL