Protein Info for HER17_RS17745 in Pectobacterium carotovorum WPP14

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00072: Response_reg" amino acids 3 to 111 (109 residues), 81.6 bits, see alignment E=4.7e-27 PF00486: Trans_reg_C" amino acids 146 to 221 (76 residues), 85.9 bits, see alignment E=1.6e-28

Best Hits

Swiss-Prot: 42% identical to COPR_PSEUB: Transcriptional activator protein CopR (copR) from Pseudomonas syringae pv. tomato

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 100% identity to pct:PC1_0662)

Predicted SEED Role

"two component system response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>HER17_RS17745 response regulator transcription factor (Pectobacterium carotovorum WPP14)
MRVLVVDDDSVLCHWLGSKLHSHGHSCRMVHDGAHALKAIKDEVYDVVLLDRMLPIMDGF
TVLRELQGSRHPPIMLLSALDRDVDRVMGLELGAEDYLGKPFNFNELRLRLDIMARRGKR
HVDNPSMLSFEDLQLDRMQRVAWRGGKRIDLTDKEIKLLIILMENPGQAITRTMLLERVW
GYNFDPQTNLIDVHMSKLRAKIDKGFPRPLIKTLRAMGYALGAVDKDKTDVGSHAE