Protein Info for HER17_RS17405 in Pectobacterium carotovorum WPP14

Annotation: Nramp family divalent metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 237 to 263 (27 residues), see Phobius details amino acids 286 to 312 (27 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 389 to 406 (18 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 20 to 377 (358 residues), 335.1 bits, see alignment E=3.5e-104 PF01566: Nramp" amino acids 38 to 383 (346 residues), 420.9 bits, see alignment E=2.1e-130

Best Hits

Swiss-Prot: 99% identical to MNTH_PECCP: Divalent metal cation transporter MntH (mntH) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03322, manganese transport protein (inferred from 99% identity to pct:PC1_0731)

MetaCyc: 80% identical to Mn2+/Fe2+: H+ symporter MntH (Escherichia coli K-12 substr. MG1655)
RXN0-2421; TRANS-RXN-241

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>HER17_RS17405 Nramp family divalent metal transporter (Pectobacterium carotovorum WPP14)
MPGSRVIESTSRTSRKVKLSLMGPAFIAAIGYIDPGNFATNIQSGAAYGYTLLWVVVWAN
LMAMLIQLLSAKLGIATGKNLAEHIRDRFPRPAVWAYWVQAEIIAMATDLAEFIGAAIGF
KLLLGVSLLEGAILTAIATFLILMLQQRGQKPLEMVIGGLLLFVAAAYIVELVFSQPELS
ALAKGMAIPSLPTSDAVLLAAGVLGATIMPHVIYLHSSLTQHEGNHTRAERYSATKVDVA
IAMTIAGFVNLAMMATAAAAFHFSGNQDIADLDKAYLTLEPLLGKAAAVIFGLSLVAAGL
SSTVVGTLAGQVVMQGFVRFHIPLWVRRTVTMLPSFIVILSGMDPTRVLVLSQVVLSFGI
ALALVPLLSFTGNRELMGTMVNGKWVQRIGQLIVVLVVSLNMYLLIDTMLGI