Protein Info for HER17_RS17380 in Pectobacterium carotovorum WPP14

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 286 (189 residues), 63.4 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 64% identical to LACF_RHIRD: Lactose transport system permease protein LacF (lacF) from Rhizobium radiobacter

KEGG orthology group: K10189, lactose/L-arabinose transport system permease protein (inferred from 99% identity to pct:PC1_0737)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>HER17_RS17380 sugar ABC transporter permease (Pectobacterium carotovorum WPP14)
MMYKPKMNRLYNINGWAFVATAVGLIALMTIYPIFKSLWLSFQSGRGVVTQFVGLGNIIR
LFSDPMFKTALWNTLTFLVIQVPIMILLSLAISSCLNSSQLKYRQWFRIAIFLPCVTSLV
AYSILFKSMFELDGVINSFLLFIHVIDDPIPWLSDPFWAKVTIIIAITWRWTGYNMIFYL
SAMQNIDKSIYEAARVDGVSPIKQFFFITIPLLKPVILFTSVTSTIGTLQLFDEVMNITN
GGPANATLTLSLYIYNLSFKFVPNFGYAATVSYVIVVFSAILALIQFKAARKG