Protein Info for HER17_RS17375 in Pectobacterium carotovorum WPP14

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 264 (165 residues), 51.4 bits, see alignment E=5.8e-18

Best Hits

Swiss-Prot: 58% identical to LACG_RHIRD: Lactose transport system permease protein LacG (lacG) from Rhizobium radiobacter

KEGG orthology group: K10190, lactose/L-arabinose transport system permease protein (inferred from 98% identity to pwa:Pecwa_0974)

Predicted SEED Role

"putative sugar ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>HER17_RS17375 carbohydrate ABC transporter permease (Pectobacterium carotovorum WPP14)
MRKSKINSILMHIFLVLMSIFSLFPFYWMVVSSTNSTSQINMGKFTFGDQLLVNFTNLTS
QVDLALVFWNTSKIALISTVSTLVVCSIAGYAFEIYSSKNRERVYVALLTTMMIPFAALM
IPLFTMFGKAGLLDTHFAVVMPTVAGAFIIFYFRQCTKTFPRELIDAARVESVAEWKIFL
YVYVPIMRASYSAAFIIVFMTSWNAFLWPLIVFQSNELKTINLVLSSFASAYSPDFGLIM
VGTVISTLPSLLIFFAMQKQFIASMTGAVK