Protein Info for HER17_RS17330 in Pectobacterium carotovorum WPP14

Annotation: beta-glucoside-specific PTS transporter subunit IIABC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 transmembrane" amino acids 100 to 131 (32 residues), see Phobius details amino acids 146 to 147 (2 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 174 to 202 (29 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 382 to 406 (25 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details TIGR01995: PTS system, beta-glucoside-specific IIABC component" amino acids 3 to 635 (633 residues), 705.7 bits, see alignment E=5.3e-216 PF00367: PTS_EIIB" amino acids 9 to 40 (32 residues), 43.9 bits, see alignment (E = 1.9e-15) PF02378: PTS_EIIC" amino acids 109 to 389 (281 residues), 126.1 bits, see alignment E=2.5e-40 PF00358: PTS_EIIA_1" amino acids 491 to 616 (126 residues), 164.8 bits, see alignment E=1.1e-52 TIGR00830: PTS system, glucose subfamily, IIA component" amino acids 492 to 612 (121 residues), 136 bits, see alignment E=6.6e-44

Best Hits

KEGG orthology group: K02755, PTS system, beta-glucosides-specific IIA component [EC: 2.7.1.69] K02756, PTS system, beta-glucosides-specific IIB component [EC: 2.7.1.69] K02757, PTS system, beta-glucosides-specific IIC component (inferred from 95% identity to eca:ECA0860)

Predicted SEED Role

"PTS system, beta-glucoside-specific IIB component (EC 2.7.1.69) / PTS system, beta-glucoside-specific IIC component / PTS system, beta-glucoside-specific IIA component" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (638 amino acids)

>HER17_RS17330 beta-glucoside-specific PTS transporter subunit IIABC (Pectobacterium carotovorum WPP14)
MNYQKLGVDILALSGGKQNVSKLTHCATRLRFEFNDSHAVQAEAIAKLPGVISVVDRGGQ
FQVVIGNDVQVTYRAILNEIGEMNSQRNAGNKQQKKGGIFTQIISVISTTFTPVIPAITG
AGMIKALLAILKLTGLISADSTTYRLLDTISDAAFFFLPVLLAYGASIKFACNPILAMTI
AGALLHPNLAQLLASGGPISFIGIPVRLADYAGSVLPIILTVWIMSYIERFAEKVSPSMI
TFFTKPMIVLLFTAPLALVVIGPFGIFLNDLVASGAAIIDGKASWLIPMLMGGLQPFLVI
TGTAWAMTPIATSQLTRNGFEMINGPGMLASNIAQGAATLCVAFKTKNKNLKQLASSAGF
TALLGITEPSLYGVTLKLKKPLIAAMIGGGCAGIYAGLAGLVRYAFVSPGLAALPAFIGE
NPMNIVHALITCAIAIVVTFALTWIMGFDDPVDETDSAQTDSAQANQRQAAPVADTAQKP
QAAEGHAEQQAIMSPLSGKLVALSDINDDVFSQGLLGQGVAIIPDNGEVVAPVSGEIITF
LESKHAIGIRADNGLELLIHVGLDTVNLNGKHFTGYIKPGDRVTAGDRLISFDLHEITRL
GYDPVTPVVIINSDEYASVVCTAPQPIAPMDTIIKVNA