Protein Info for HER17_RS17220 in Pectobacterium carotovorum WPP14

Annotation: sulfate/thiosulfate ABC transporter permease CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 65 to 92 (28 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 16 to 277 (262 residues), 370.7 bits, see alignment E=4.6e-115 TIGR00969: sulfate ABC transporter, permease protein" amino acids 16 to 276 (261 residues), 349.1 bits, see alignment E=1.7e-108 PF00528: BPD_transp_1" amino acids 84 to 282 (199 residues), 88.3 bits, see alignment E=2.7e-29

Best Hits

Swiss-Prot: 81% identical to CYST_ECOLI: Sulfate transport system permease protein CysT (cysU) from Escherichia coli (strain K12)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 98% identity to pct:PC1_0766)

MetaCyc: 81% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>HER17_RS17220 sulfate/thiosulfate ABC transporter permease CysT (Pectobacterium carotovorum WPP14)
MSLGSGHFFSGSGKRVLPGFALSLGSSLLFVCLILLLPLSALVMQLSEMSLAQYWTVISN
PQVVAAYKVTLLAAGLATVFNAGFGLLMAWILTRYRFPGRALLDGLMDLPFALPTAVAGL
TLAALFSTTGWYGAWLAEYGIKVSYTWLGITVAMAFTSIPFVVRTVQPVLEDLGPEYEEA
AQTLGANRWQCFRYVILPELTPALLTGTALSFARSLGEFGAVIFIAGNIAWQTEVVSLMI
FIRLQEFDFPAASAIASVVLAASLLILFAVNVLQSRFGQRTRSV