Protein Info for HER17_RS17205 in Pectobacterium carotovorum WPP14

Annotation: MacB family efflux pump subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 transmembrane" amino acids 275 to 295 (21 residues), see Phobius details amino acids 523 to 549 (27 residues), see Phobius details amino acids 575 to 602 (28 residues), see Phobius details amino acids 609 to 633 (25 residues), see Phobius details PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 111.9 bits, see alignment E=5.7e-36 PF12704: MacB_PCD" amino acids 274 to 493 (220 residues), 151.8 bits, see alignment E=5e-48 PF02687: FtsX" amino acids 529 to 643 (115 residues), 74.8 bits, see alignment E=8.7e-25

Best Hits

Swiss-Prot: 96% identical to MACB_PECAS: Macrolide export ATP-binding/permease protein MacB (macB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 98% identity to pct:PC1_0769)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (650 amino acids)

>HER17_RS17205 MacB family efflux pump subunit (Pectobacterium carotovorum WPP14)
MSTSLLKLTGITRCFSNGEQDVTVLKDINLTINQGEMVAIVGASGSGKSTLMNILGCLDK
PSSGDYQVAGRAVGKLDNDQLAELRREHFGFIFQRYHLLGDLSALGNVEVPAIYAGKSRL
ARRQRAAELLTRLGLENRLHYRPSQLSGGQQQRVSIARALMNGGGIILADEPTGALDTHS
GNEVLSILRDLHRQGNTVVIVTHDMTIAEHAQRIIELRDGEVIADRQTRPEEATEPPPKA
ASSPATSALNQFKDRFIDAFKMALLAMNAQRMRTFLTMLGIIIGIASVVSVVALGKGSQE
QVLADINSMGTSTLEIFPGKDFGDMDASAIQTLRASDIQPLTQQPYVHSVTPSISTSVTM
RYGNIAVSASISGVGEQFFTVRGYTLQRGMLFPRSSVDELKQDAVIDKNTRDKLFPHGED
PIGQVILLGSLPVRIIGVVSKNQGGFGSDENLNVWVPYTTVMKRMVGQSYLKSITVRVKD
NVDMNVAEKSITALLTQRHGTKDFFIMNTDSIRQMIEKTTTTLTLLVSMIALISLLVGGI
GVMNIMLVSVTERTREIGVRMAVGARTSDIMQQFLIEAVLVCLFGGIIGVALSLAIGVLF
AQFSSNFAMIYSSSSIIAAFLCSSLIGIIFGFFPARRAARMEPIHALERE