Protein Info for HER17_RS17200 in Pectobacterium carotovorum WPP14

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 271 (232 residues), 136.5 bits, see alignment E=5e-44 PF16576: HlyD_D23" amino acids 48 to 268 (221 residues), 55 bits, see alignment E=1.5e-18 PF13533: Biotin_lipoyl_2" amino acids 63 to 109 (47 residues), 34.7 bits, see alignment 2.5e-12 PF13437: HlyD_3" amino acids 187 to 272 (86 residues), 50.1 bits, see alignment E=7.9e-17

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 96% identity to pct:PC1_0770)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>HER17_RS17200 efflux RND transporter periplasmic adaptor subunit (Pectobacterium carotovorum WPP14)
MQSRFFTRRRTTIALGLIAAAVLLHLFFNKPSPTPNTLTTAAEIADLEQTVLADGKIEAQ
KLVSVGAQASGQIKALHVELGDKVKKGQLIAEIDDLTQQDTLKNGEAALKNIQAQRAAKL
AELRNNELSWQRQQMLMKRGVGAQADYDSAKATLDATRANIDALDAQIIQAQITVNTAKV
NLGYTQIRSPMDGTVVAIPVEAGQTVNAIQTTPTIAKVANLDTMTIKVKISEADVVKVKT
GMPVWFSILGEPNNRYEATLSSIEPAPDSINTDSTTTSSSSSSSTSSSSSTAIYYNGLFD
VKNPDGVLRISMTAQVYILLSSVKNAIVVPATALTSRDGMWYVQVVNANKKVESRLVTLG
LNDNVRTQIRSGLSVGEQVVVSPSSGDVASTHPGPPMGM