Protein Info for HER17_RS16900 in Pectobacterium carotovorum WPP14

Annotation: ABC transporter six-transmembrane domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 31 to 56 (26 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details PF13748: ABC_membrane_3" amino acids 20 to 256 (237 residues), 266 bits, see alignment E=1.4e-83

Best Hits

KEGG orthology group: None (inferred from 96% identity to eca:ECA0947)

Predicted SEED Role

"probable integral membrane protein NMA1777"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>HER17_RS16900 ABC transporter six-transmembrane domain-containing protein (Pectobacterium carotovorum WPP14)
MQTHNISEPVKVSHSAGVTLKKLGKLHGKKLILTLLLVVAENVTYLLYPLMAGFAINAIL
NAQPWHAVLYALMVFIMWAIGAARRSVDTRTFARIYAALAVPVILAQRKENHNHSTIAAR
VALSREFVDFFEIHLPVLITSLASIIGAALMLLVIESWAGVACIVILLFFALFLPSYTRK
NEALFGKLNNRLEKEVGFVSSATAASLTKHYHVLAGLRIRLSDREALGYLAIGAAAAVLF
SLTIVYMTLNGGTNAGHIYSVMTYMWVFAMSLDDAPGLLEKYSQLKDIGKRVDTGVV