Protein Info for HER17_RS16640 in Pectobacterium carotovorum WPP14

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details PF12833: HTH_18" amino acids 263 to 341 (79 residues), 77.8 bits, see alignment E=3.3e-26

Best Hits

KEGG orthology group: None (inferred from 81% identity to eca:ECA0973)

Predicted SEED Role

"AraC-family transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>HER17_RS16640 helix-turn-helix domain-containing protein (Pectobacterium carotovorum WPP14)
MTAIPLPFITALLLVILFFRIQFLAIQNKETKKRNTKAEAILIGASCLALTLVALRWGSH
VALPVFIQPAIAASIPPLLWLCLFPYGEKVSDALNRNRRRSLRHLLPPLLILGASAIQNR
TTVPLIDLMLVSVYFGYGAMLIYSARHRQTSSLLWKSAPFIAGLYVLISGAIDIVIALDI
AFYSGNSAATIITVFHIIMLAILTLLIVTYSAQHTQTELSITHDQKPEALPATDDEHQLA
KTLDDFIRTHALYTDPSMTLQRLSRRMGIPLRRLSETINRVHGRNFSQVMNEYRIEEAKR
LLSQTDARITDIMLESGFQTKSNFNREFLRLTGMSPSVWRSQHPLRAQATASATPPEENR