Protein Info for HER17_RS16580 in Pectobacterium carotovorum WPP14

Annotation: phosphoenolpyruvate--protein phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 PF13185: GAF_2" amino acids 17 to 154 (138 residues), 59.4 bits, see alignment E=1.4e-19 PF01590: GAF" amino acids 18 to 153 (136 residues), 74.1 bits, see alignment E=5e-24 PF13492: GAF_3" amino acids 19 to 151 (133 residues), 35.8 bits, see alignment E=3e-12 PF05524: PEP-utilisers_N" amino acids 174 to 294 (121 residues), 86.4 bits, see alignment E=5.1e-28 TIGR01417: phosphoenolpyruvate-protein phosphotransferase" amino acids 202 to 729 (528 residues), 413.7 bits, see alignment E=5.5e-128 PF00391: PEP-utilizers" amino acids 320 to 391 (72 residues), 55.8 bits, see alignment E=9.2e-19 PF02896: PEP-utilizers_C" amino acids 422 to 706 (285 residues), 345.4 bits, see alignment E=7.4e-107

Best Hits

Swiss-Prot: 74% identical to PT1P_SALTY: Phosphoenolpyruvate-dependent phosphotransferase system (ptsP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08484, phosphotransferase system, enzyme I, PtsP [EC: 2.7.3.9] (inferred from 98% identity to eca:ECA0986)

MetaCyc: 74% identical to phosphoenolpyruvate-protein phosphotransferase PtsP (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphoenolpyruvate-protein phosphotransferase, nitrogen regulation associated"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.9

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (748 amino acids)

>HER17_RS16580 phosphoenolpyruvate--protein phosphotransferase (Pectobacterium carotovorum WPP14)
MLTRLREIVENVAATARLSDALDILVNETCQAMDTEVCSIYLADHDRQCYYLMATRGLKK
PRGRTVTLAFGQGIVGLVGQRAEPINLADARAHPSFKYIPAVKEQHFRSFLGVPIIYRRH
LLGVLVVQQREHRQFDKNEESFMVTLATQMAAILSLSQIKTLFGQYRQTRVKALVAAPGV
AIAPGWQDCTQPSLEQVFPASSLDSERERSRLTQALEEATAEFRRFSKRFSASAQKESAA
IFDLYSHLLNDARLKRELFQEVDAGNAAEWAVKLVIERFAAQFTNLQDTYLRERAGDLRA
LGQRLLFHLDDNAQIMGQWPERFILVADELTATLLAELPPERLAGVVVYDGAANSHAAIL
VRAMGIPTLVGADIQPDMLHQRLLIIDGYRGELLVDPEPVLVQEYQRLLTEENELTRLAE
GEMEQPAVLKSGERIQVMLNAGLSAEHEKRFINQVDGVGLYRTEIPFMLQSGFPSEDEQM
AQYQSMLALYPTRPVMLRTLDIGADKPLPYLPISEENPCLGWRGIRITLDQPEIFLIQVR
AMLRANAHSGNLNILLPMISSLDEISEARRLIDQAAGEVEELLGFPQPKPRIGIMIEVPS
MLFLLPHLASRIDFVSVGTNDLTQYLLAVDRNNAHVASLYDSLHPSMLHALNMIAVECER
HNIPLSVCGEMAGEALGALLLTGLGYRSLSMNGRSVARIKYLLRQITLTESQALVKQLLN
AQSATEVRQWAAIFMEERGLGGLIRGGR