Protein Info for HER17_RS16125 in Pectobacterium carotovorum WPP14

Annotation: HlyD family type I secretion periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details PF00529: CusB_dom_1" amino acids 28 to 375 (348 residues), 35.2 bits, see alignment E=1.9e-12 PF16576: HlyD_D23" amino acids 54 to 320 (267 residues), 37.2 bits, see alignment E=4.1e-13 PF13533: Biotin_lipoyl_2" amino acids 64 to 91 (28 residues), 25.3 bits, see alignment (E = 2.1e-09) TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 183 to 389 (207 residues), 210.1 bits, see alignment E=2.9e-66 PF13437: HlyD_3" amino acids 238 to 341 (104 residues), 60.2 bits, see alignment E=5.8e-20

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 98% identity to pct:PC1_0991)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>HER17_RS16125 HlyD family type I secretion periplasmic adaptor subunit (Pectobacterium carotovorum WPP14)
MSSITIHDDLKRQGRRVSVIIWLSLLGLIVFFIWATFAVLDEVSVGSGKVTPSTRAQVIE
SLDGGIIGQIYVQQGNVVEKGQVLAQLDINRFQSVYGEAFSRVQTLRASAERLHAELSGA
PLKFSAETMKEPALAARERQLYESRLRNRDETVANLQQSMRLVEQELRMTEPLVQRGAAS
AVEVIRLRRQISEIRGKIDEANNQYAVRAREEQVKNNADLEAQMEVVSGKADQLKRATIT
SPVRGIVKDIQVTTVGGVLQPGGKLMEIVPLEDQLLIETRINPRDIAYIRPGLPATVKIT
AYDSSIYGNLTGEVESVSPDTLQDEVRRDQFYYRIYVRTTQAELTNKAGEKFPIVPGMVA
SVEIKTGQKSVMDYLIKPLNKVNEALRER