Protein Info for HER17_RS16010 in Pectobacterium carotovorum WPP14

Annotation: mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 172 to 188 (17 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 190 to 258 (69 residues), 57.9 bits, see alignment E=8.9e-20 PF21082: MS_channel_3rd" amino acids 341 to 402 (62 residues), 24.9 bits, see alignment E=2.3e-09

Best Hits

Swiss-Prot: 63% identical to YBDG_SHIFL: Miniconductance mechanosensitive channel YbdG (ybdG) from Shigella flexneri

KEGG orthology group: None (inferred from 97% identity to pct:PC1_1014)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>HER17_RS16010 mechanosensitive ion channel (Pectobacterium carotovorum WPP14)
MQQNLALWLRDAGIEHASIIALLIVLGLILLISAVIHLIFHQVVLKRMVLRSLNKPGKTE
GHGWKQALTQHNLFNRLAFLLQGVILNIQVFVWLPSQSETREALIICSQVWIMVFALLSL
FSLLDVLLNVSARTKVAAQLPLRGIFQSLKLIATIVISIMVVSLLIGKSPLILISGLGAM
AAVLMLVFKDPIMGLVAGIQLSANDMLTLGDWLEMPKYGADGAVIDIGLTTVKVRNWDNT
VTTIPTYALVSDSFKNWRSMSESGGRRIKRSINIDTTSVHFMTEDEQARLLRSKLLSPYI
QNKKNELEQHNAQSDSDLTSPLNGRRLTNLGTFRAYLQVYLRTHPGIHKGMTLMVRQLAP
TSEGVPLEIYAFANTTAWVDYESIQSDIFDHIFAILPEFDLRIHQTPTGHDMRIMAQQMT
APKAQK