Protein Info for HER17_RS15935 in Pectobacterium carotovorum WPP14

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 12 to 282 (271 residues), 400.9 bits, E=8e-124
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 12 to 620 (609 residues), 1025.6 bits, E=0
• PF00676: E1_dh
  • amino acids 123 to 186 (64 residues), 25.4 bits, E=2.1e-09
• PF02779: Transket_pyr
  • amino acids 319 to 481 (163 residues), 164.3 bits, E=6.8e-52
• PF02780: Transketolase_C
  • amino acids 496 to 612 (117 residues), 90.1 bits, E=3.2e-29

Best Hits

Swiss-Prot: 99% identical to DXS_PECCP: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 98% identity to pwa:Pecwa_3281)

MetaCyc: 83% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• isoprene biosynthesis I (9/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Protein Sequence (621 amino acids)

>HER17_RS15935 1-deoxy-D-xylulose-5-phosphate synthase (Pectobacterium carotovorum WPP14)
MSFDTAKYPTLALVETPDELRLLPKESLPKLCDELRQYLLDSVSRSSGHFASGLGTVELT
VALHYVYNTPFDHLVWDVGHQAYPHKILTGRRERISTIRQKGGLHPFPWRDESEYDVLSV
GHSSTSISAGLGMAVAAEREGKGRRTVCVIGDGAITAGMAFEAMNHAGDIKSDLLVVLND
NEMSISENVGALNNHLAQLLSGKLYASLREGGKKVLSGLPPIKELVKRTEEHLKGMVVPG
TLFEELGFNYIGPVDGHDVQALAHTLKNMRNLKGPQLLHIMTKKGKGYAPAEQDPISWHA
VPKFDPASGTLPKSKEGAQPTYSKIFGQWLQETAAKDSKLMAITPAMREGSGMVQFSRDY
PQQYFDVAIAEQHAVTFAAGLAVGGYHPVVAIYSTFLQRAYDQVIHDVAIQNLPVLFAID
RGGIVGADGQTHQGAFDLSFLRCIPNMIIMTPSDENECRQMLHTGYHYQKGPTAVRYPRG
NGTGTALTPLSELPIGKGVVRRQGETIAILNFGTLLPEAQIAAEKLNATLVDMRFVKPLD
EALLEELAQSHSTFVTLEENAVMGGAGSGVNEFLMAKRLAVSVLNIGLPDVFIPQGSQEE
IRADLGLDATGIERRITQWME