Protein Info for HER17_RS15800 in Pectobacterium carotovorum WPP14

Annotation: SmdA family multidrug ABC transporter permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 56 to 77 (22 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 21 to 291 (271 residues), 135.5 bits, see alignment E=3e-43 PF00005: ABC_tran" amino acids 352 to 500 (149 residues), 101.8 bits, see alignment E=5.1e-33

Best Hits

Swiss-Prot: 76% identical to MDLA_ECOLI: Multidrug resistance-like ATP-binding protein MdlA (mdlA) from Escherichia coli (strain K12)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 96% identity to eca:ECA1158)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (589 amino acids)

>HER17_RS15800 SmdA family multidrug ABC transporter permease/ATP-binding protein (Pectobacterium carotovorum WPP14)
MRLFAQLSWYFRREWRRYLGAIALLIAIAILQLLPPKLVGVIVDGVTQHGMSMAEMMKWI
GVMLLTAVMVYLLRYVWRVFLFGASYQLAVELREDFYRQLSRQHPAFYQRHRTGDLMARA
TNDVDRVVFAAGEGVLTLVDSMVMGCAVLVVMCTQISWELTLLALLPMPFMAIFIKRYGT
QLHNRFKSAQAAFSSLNDQAQESLTSIRMIKAFGLENYQSARFAQVAADAGAKNMHVARV
DARFDPTIYIAVGLSNLLAIGGGSWMVINGSLTLGLLTSFVMYLGLMIWPMLALAWMFNI
VERGSAAYSRIRQLLAEDLVVKDGEESLPAERGVLDVNISAFRYPDNARDALQHIQFTLA
PGNMLGLCGPTGSGKSTLLALILRHFDTQSGEIRYHDRPLSAIRLDELRSRFAVVGQMPF
LFSDTVARNIALGRPDATQQQIEQAARLASVHDDILRLPQGYQTEVGERGVMLSGGQKQR
IAIARALLLDAEILVLDDALSAVDGRTEHQILQNLKTWGEKRTLIISAHRLSALTEANEI
VVLQQGQAVQRGTHRTLAAQPGWYRDMHRYQQLEAALDDVPQLEGTKNE