Protein Info for HER17_RS15730 in Pectobacterium carotovorum WPP14

Annotation: multidrug efflux transporter transcriptional repressor AcrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF00440: TetR_N" amino acids 16 to 62 (47 residues), 72 bits, see alignment 2.8e-24 PF08361: TetR_C_2" amino acids 84 to 204 (121 residues), 184.2 bits, see alignment E=8.6e-59

Best Hits

Swiss-Prot: 59% identical to ACRR_ECOL6: HTH-type transcriptional regulator AcrR (acrR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03577, TetR/AcrR family transcriptional regulator, acrAB operon repressor (inferred from 97% identity to pct:PC1_1071)

Predicted SEED Role

"Transcription repressor of multidrug efflux pump acrAB operon, TetR (AcrR) family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>HER17_RS15730 multidrug efflux transporter transcriptional repressor AcrR (Pectobacterium carotovorum WPP14)
MARKTKKQAQETRQHILDTALRVFSEHGVSATSLSDIATAAGVTRGAIYWHFKNKAEIFD
EIWALAESKIDEFEIEYQTKFPDNPLRVMRELLIYMLRLTVSDTHWRSIMEIAFHKCEFV
GEMLQSYNARKELYLSCYVDIEENLIKCIRVGMLPTDIHPRRAAIAMRAYFSGVMENWLF
MPESFDLDQEAPALVDAFIDMLHFSPALRKLAE