Protein Info for HER17_RS15655 in Pectobacterium carotovorum WPP14

Annotation: carbon starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 488 to 508 (21 residues), see Phobius details amino acids 533 to 552 (20 residues), see Phobius details amino acids 565 to 589 (25 residues), see Phobius details amino acids 596 to 616 (21 residues), see Phobius details amino acids 665 to 685 (21 residues), see Phobius details PF02554: CstA" amino acids 34 to 406 (373 residues), 560.6 bits, see alignment E=1.6e-172 PF13722: CstA_5TM" amino acids 486 to 614 (129 residues), 133.8 bits, see alignment E=4e-43

Best Hits

Swiss-Prot: 87% identical to BTST_ECOLI: Pyruvate/proton symporter BtsT (btsT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eca:ECA1187)

MetaCyc: 87% identical to pyruvate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-335

Predicted SEED Role

"Carbon starvation protein A paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (717 amino acids)

>HER17_RS15655 carbon starvation protein A (Pectobacterium carotovorum WPP14)
MKSNAILKHIPWMILGIIGAACLGVVALRRGEHISALWIIVASVAVYLVAYRYYSLYIAQ
KVMQLDPTRATPAVVNNDGLNYVPTNRNVLFGHHFAAIAGAGPLVGPVLAAQVGYLPGTL
WLLGGVVLAGAVQDFMVLFISTRRNGASLGEIVKKELGPVPGTIALFGCFLIMIIILAVL
ALIVVKALAESPWGVFTVCSTVPIALFMGVYMRFIRPGKVGEISVIGIVLLVLAIWFGGV
VAHDPYWGPALTFKDTTITYTLIGYAFVSALLPVWLILAPRDYLATFLKIGVIVGLAIGI
VILNPDLKMPAVTQFVDGTGPVWKGTLFPFLFITIACGAVSGFHALIASGTTPKLMANEN
DARFIGYGAMLMESFVAVMALVAASIIEPGLYFAMNTPPAALGITMPDLHRLGTADAPMI
LAQLQDVSAHAAATVSSWGFVISPEQILQTAKDIGEPSVLNRAGGAPTLAVGIAHVFHQI
IPGANMGFWYHFGILFEALFILTALDAGTRAGRFMLQDLLGNFVPFLKKTDSLIAGMIGT
AGCVGLWGYLLYQGVVDPLGGVKSLWPLFGISNQMLAAVALILGTVILIKMKRTQYIWVT
LVPAIWLLICTTWALGLKLFSDNPQLEGFFYMANMFKGKIAEGGAELSAQQISNMNHIVT
NNYTNAGLSILFLIVVYSIIAYGIKAALAARKVAERTDQETPYVPVPEGGVKVSSGH