Protein Info for HER17_RS15590 in Pectobacterium carotovorum WPP14

Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 14 to 232 (219 residues), 298.2 bits, E=1.6e-93
• PF01209: Ubie_methyltran
  • amino acids 46 to 159 (114 residues), 38.2 bits, E=5.3e-13
• PF05175: MTS
  • amino acids 54 to 115 (62 residues), 25 bits, E=6.8e-09
• PF07021: MetW
  • amino acids 55 to 148 (94 residues), 21.1 bits, E=1.1e-07
• PF13489: Methyltransf_23
  • amino acids 55 to 170 (116 residues), 85.2 bits, E=2.2e-27
• PF13847: Methyltransf_31
  • amino acids 55 to 162 (108 residues), 67 bits, E=8.4e-22
• PF06325: PrmA
  • amino acids 55 to 161 (107 residues), 28.6 bits, E=5.1e-10
• PF02353: CMAS
  • amino acids 55 to 182 (128 residues), 35.7 bits, E=3.2e-12
• PF13649: Methyltransf_25
  • amino acids 58 to 151 (94 residues), 70.5 bits, E=7.9e-23
• PF08242: Methyltransf_12
  • amino acids 59 to 153 (95 residues), 59.4 bits, E=2.4e-19
• PF08241: Methyltransf_11
  • amino acids 59 to 155 (97 residues), 80.3 bits, E=6.8e-26

Best Hits

Swiss-Prot: 98% identical to UBIG_PECCP: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 98% identity to pct:PC1_1104)

MetaCyc: 80% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (53/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Protein Sequence (239 amino acids)

>HER17_RS15590 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Pectobacterium carotovorum WPP14)
MNVENQTPNVDHQEIAKFEAIASRWWDLEGEFKPLHRINPLRLGYISQHAEGLFGKKVLD
VGCGGGILAESMAREGADVTGLDMGAEPLQVARLHALESGVAVDYVQETVEAHAHAHPGL
YDVVTCMEMLEHVPDPQSVVQACARLVKPGGHVFFSTINRNAKAWMMAVIGAEYVLKMVP
RGTHDIKKFIRPAELMHWVDSTPLREKHITGLHYNPLTDHFKLGPNVDVNYMLHTRHDK