Protein Info for HER17_RS15425 in Pectobacterium carotovorum WPP14

Annotation: thioredoxin-dependent thiol peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF08534: Redoxin" amino acids 5 to 138 (134 residues), 93 bits, see alignment E=2.4e-30 PF00578: AhpC-TSA" amino acids 7 to 134 (128 residues), 138.8 bits, see alignment E=1.4e-44 PF02630: SCO1-SenC" amino acids 11 to 131 (121 residues), 24 bits, see alignment E=5.2e-09

Best Hits

Swiss-Prot: 88% identical to BCP_SHIFL: Putative peroxiredoxin bcp (bcp) from Shigella flexneri

KEGG orthology group: K03564, peroxiredoxin Q/BCP [EC: 1.11.1.15] (inferred from 99% identity to pct:PC1_1135)

MetaCyc: 88% identical to thiol peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Bcp-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>HER17_RS15425 thioredoxin-dependent thiol peroxidase (Pectobacterium carotovorum WPP14)
MNTLKAGDIAPKFSLPDQDGEQVNLTDFQGQKVLVYFYPKAMTPGCTVQACGLRDNMDDL
KKHGVEVLGISTDKSEKLSRFVEKEVLNFTLLSDEDHQVSEGFGVWGEKTFMGKTYDGIH
RISFLIDENGKVEKVFDDFKTSNHHDIVLDYLKSA