Protein Info for HER17_RS15395 in Pectobacterium carotovorum WPP14

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08351: TmcA_N
  • amino acids 56 to 150 (95 residues), 31.7 bits, E=4.8e-11
• PF05127: Helicase_RecD
  • amino acids 196 to 342 (147 residues), 139.9 bits, E=2.9e-44
• PF13718: GNAT_acetyltr_2
  • amino acids 383 to 489 (107 residues), 38.5 bits, E=3e-13
  • amino acids 492 to 548 (57 residues), 28 bits, 5e-10
• PF00583: Acetyltransf_1
  • amino acids 454 to 524 (71 residues), 29.8 bits, E=2.3e-10
• PF13673: Acetyltransf_10
  • amino acids 467 to 534 (68 residues), 30.9 bits, E=8.5e-11
• PF13508: Acetyltransf_7
  • amino acids 468 to 525 (58 residues), 34.4 bits, 8.1e-12
• PF17176: tRNA_bind_3
  • amino acids 552 to 670 (119 residues), 143 bits, E=1.9e-45

Best Hits

Swiss-Prot: 81% identical to TMCA_PECAS: tRNA(Met) cytidine acetyltransferase TmcA (tmcA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K06957, tRNA(Met) cytidine acetyltransferase [EC: 2.3.1.-] (inferred from 85% identity to pct:PC1_1143)

Predicted SEED Role

"Predicted P-loop ATPase fused to an acetyltransferase COG1444"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Protein Sequence (684 amino acids)

>HER17_RS15395 GNAT family N-acetyltransferase (Pectobacterium carotovorum WPP14)
MMLRDFLHSQRQQQRYGVRRLLVLSGEANWCEEQALALSGQLSSDLLWVSESAPDSVTAL
PASRVRTLLGREFLHAVFDARSGLDVEALAMLSGTLQAGSWLIMLVPSWQAWPTQPDQDS
LRWSEQEQPIATPHFIQHFQRQLLADEDVVLWQQDQAFVIRPLAARSDWQPASGEPTAQQ
QHILHELNTSESGVLVITAPRGRGKSALAGMLTQRSLGACWITAPSRAAADILQQHARAD
VPFWAPDALLEHCRLHGAPRVDWLLIDEAAAIPSSVLSALLPYFSRILMTTTVQGYEGTG
RGFLLKFCATLPQWRAFTLDEPLRWAVNDPLERVLDQALLFNEPEAFHSPQPPDRPIPSS
ALESRIERADDWLTHPDRLKCCYALLCSAHYRTSPLDLRRLMDAPGMHIASAQMAGEIGG
VLWLVEEGGLSASLAHEVWAGRRRPRGNLVAQSLAAHAGLWHAPTLRARRVSRIAVAPSY
RRQGIGRALIAEQMREAQRQALDYLSVSFGYQPELWAFWQSCGFQLVRIGSHLEASSGCY
SAMAILPLSDAGHKLAEQGSRQLARDWFWLQRLIPLNLALPQTGNTELDEGDWRELAGFA
FAHRPMEASFAALCRLLSHTTLLLPALRLLAEKPDESEQIATTLGLTGKKTLLKRWREET
AAALVELDAQRSERWRRTVVFGDS