Protein Info for HER17_RS15255 in Pectobacterium carotovorum WPP14

Annotation: endolytic peptidoglycan transglycosylase RlpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03330: DPBB_1" amino acids 77 to 165 (89 residues), 83 bits, see alignment E=1.5e-27 TIGR00413: rare lipoprotein A" amino acids 79 to 178 (100 residues), 113.8 bits, see alignment E=5.2e-37 PF05036: SPOR" amino acids 296 to 366 (71 residues), 53 bits, see alignment E=3.7e-18

Best Hits

Swiss-Prot: 63% identical to RLPA_YERPE: Endolytic peptidoglycan transglycosylase RlpA (rlpA) from Yersinia pestis

KEGG orthology group: K03642, rare lipoprotein A (inferred from 93% identity to eca:ECA1301)

Predicted SEED Role

"Rare lipoprotein A precursor" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>HER17_RS15255 endolytic peptidoglycan transglycosylase RlpA (Pectobacterium carotovorum WPP14)
MRKDWLWVGVATLALAACTTTEQRQPTPPVTQVYSGPTEEIGGAEPRYEPYNQGTLQDYN
IKGKTYKIVKNPQNFSETGLAAWYGEEASGNRTSIGETFDPNAITAAHPTLPLPSYVRVT
NLSNGRRLVVRVNDRGPYTPGRIIDLSKAAGDRLNISNNTKVKVDFINVAPDGTLSGPGT
VGTTVAKQSFALPERPSFGASGLGTPMMETTSPTPNSAVRPISNSSLSAPAESTQPQSSA
PSHSGGFLGAPSALRAGVVESSVTPAVAPSSSAAPMNVAPAAAAVTAPAAATPSATGRYV
VQVGALSDQQRAQTWQRSLSERFRVAGKVTASGGLYRIQLGPFQNRQQAAELQQRLSVEA
QQQSFITAAPSTL