Protein Info for HER17_RS14810 in Pectobacterium carotovorum WPP14

Annotation: CDF family zinc transporter ZitB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 150 to 176 (27 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 12 to 288 (277 residues), 316.9 bits, see alignment E=5.8e-99 PF01545: Cation_efflux" amino acids 16 to 208 (193 residues), 178.3 bits, see alignment E=7.9e-57

Best Hits

Swiss-Prot: 94% identical to ZITB_PECAS: Zinc transporter ZitB (zitB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 94% identity to eca:ECA1380)

MetaCyc: 67% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Zinc transporter ZitB" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>HER17_RS14810 CDF family zinc transporter ZitB (Pectobacterium carotovorum WPP14)
MAHNHSHTESGNSKRLLAAFIITATFMVAEVIGGLLSGSLALLADAGHMLTDAAALFVAL
VAVRFAQRKPNARHTFGYLRLTTLAAFVNALTLMLITAFIFWEAIQRFYDPQPVAGVPML
LVAVAGLVANIVAFWLLHHGSEEKNINVRAAALHVLGDLLGSVGAIAAAIIILYTNWTPI
DPILSILVSCLVLRSAWALLKESIHELLEGTPSQLSVEVLQKDLTLNIPEVRNIHHVHLW
QVGEKPMMTLHAQVVPPHDHDALLRRIQEYLLKHYQIEHATVQMEYQRCDDDHCAFHHQE
SHHHESHDAEGHHHKH