Protein Info for HER17_RS14670 in Pectobacterium carotovorum WPP14

Annotation: formate dehydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 7 to 290 (284 residues), 486 bits, E=1.5e-150
• PF12838: Fer4_7
  • amino acids 38 to 114 (77 residues), 28.5 bits, E=7.5e-10
• PF13247: Fer4_11
  • amino acids 92 to 188 (97 residues), 88.7 bits, E=1.1e-28
• PF13237: Fer4_10
  • amino acids 94 to 144 (51 residues), 34.7 bits, 6.4e-12
• PF00037: Fer4
  • amino acids 130 to 147 (18 residues), 22.7 bits, see alignment (E = 3e-08)
• PF09163: Form-deh_trans
  • amino acids 246 to 289 (44 residues), 68.1 bits, 2e-22

Best Hits

Swiss-Prot: 80% identical to FDNH_ECOLI: Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (fdnH) from Escherichia coli (strain K12)

KEGG orthology group: K08349, formate dehydrogenase-N, beta subunit [EC: 1.2.1.2] (inferred from 98% identity to eca:ECA1407)

MetaCyc: 80% identical to formate dehydrogenase N subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase N beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate to dimethyl sulfoxide electron transfer (2/2 steps found)
• nitrate reduction III (dissimilatory) (2/2 steps found)
• formate oxidation to CO₂ (1/1 steps found)
• formate to nitrite electron transfer (2/3 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Protein Sequence (302 amino acids)

>HER17_RS14670 formate dehydrogenase subunit beta (Pectobacterium carotovorum WPP14)
MSMQSQDIIKRSATNGFTPPPHVRNDKSEVAKLIDVTTCIGCKGCQVACSEWNDIRDEVG
HNFGVYDNPADLSAKSWTLMRFSEVEENDRLEWLIRKDGCMHCSDPGCLKACPSAGAVIQ
YANGIVDFQSEHCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIRFGTKEEMKHLAEERIADLKSRGYKNAGLYDPQGVGGTHVMYVLHHADRPSLYNNL
PDDPQISTPVNLWKGILKPLSALGFVATFAGLMFHYIGVGPNTEETEHEHEGEDKEGGDK
HE