Protein Info for HER17_RS14655 in Pectobacterium carotovorum WPP14

Annotation: iron-sulfur cluster carrier protein ApbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF10609: ParA" amino acids 106 to 349 (244 residues), 334.8 bits, see alignment E=7.4e-104 PF13614: AAA_31" amino acids 108 to 146 (39 residues), 31.5 bits, see alignment 4.3e-11 PF09140: MipZ" amino acids 109 to 237 (129 residues), 30.9 bits, see alignment E=4.4e-11 PF01656: CbiA" amino acids 110 to 266 (157 residues), 36.6 bits, see alignment E=1e-12

Best Hits

Swiss-Prot: 79% identical to APBC_ECOLI: Iron-sulfur cluster carrier protein (mrp) from Escherichia coli (strain K12)

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 98% identity to pwa:Pecwa_3043)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>HER17_RS14655 iron-sulfur cluster carrier protein ApbC (Pectobacterium carotovorum WPP14)
MNATVPEQRPEALRAMVTGVLSTFQHPTLKNNLTTLNALRHCALLDNVLHIDLTMPFVWL
SGLAVLKETVSDELLRLSGAKAIEWRLTHDIATLRRVNDQAGVKGVKNIIAVSSGKGGVG
KSSTAVNMALALAAEGANVGILDADIYGPSIPTMLGSASERPTSPDGQHMAPIIAHGLAT
NSIGYLVTDDNAMVWRGPMASKALLQLLQDTLWPDLDYLVLDMPPGTGDIQLTLAQSIPV
TGAVVVTTPQDIALMDAMKGIAMFEKVSVPVLGIVENMSVHICSNCGHLEPIFGTGGAQK
LAEKYHCSLLGQLPLHISLREDLDRGEPTVVSQPDSEFTSLYRELAGQVAAQLYWQGDTI
PGEISFRAL