Protein Info for HER17_RS14460 in Pectobacterium carotovorum WPP14

Annotation: diguanylate cyclase AdrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 85 to 113 (29 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details PF05230: MASE2" amino acids 23 to 110 (88 residues), 108.9 bits, see alignment E=1e-35 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 191 to 352 (162 residues), 177.4 bits, see alignment E=9.4e-57 PF00990: GGDEF" amino acids 194 to 349 (156 residues), 143.7 bits, see alignment E=4.5e-46

Best Hits

Swiss-Prot: 47% identical to DGCC_ECOLI: Probable diguanylate cyclase DgcC (dgcC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to pct:PC1_1329)

MetaCyc: 47% identical to diguanylate cyclase DgcC (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"putative signaling membrane protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>HER17_RS14460 diguanylate cyclase AdrA (Pectobacterium carotovorum WPP14)
MSASPPTFLTVDVRRSGLRFSQRVYIPRIVGTILCALFISSVLITRPVPTLLWVLLLLNT
FIWPHIAYTLSLRSRDPMQCEKRNLLIDVAFGGIWIGFMGVNLLPSAVIAAMVGMNCTAG
GGVKLLVQGIVLQCVACVLVLVLFSVPVSLDTTPLQLYACLPMLLVYPIFLGYVTYTTAL
KLAEHKRMLMEVSIHDGMTSLYNRHHWERLLKHEYDSCQRYKRTATLVLFDIDHFKAFND
NFGHNVGDQAILLLARELTSGFRETDVIGRFGGDEFAVILPQTSAGEALDAVNRIRESLS
LKFLNQTPQLAVFVSVGIAEISPEMGQYIDWLKTADMALYRAKNKGRRRTEVA