Protein Info for HER17_RS14410 in Pectobacterium carotovorum WPP14

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 330 (278 residues), 147.8 bits, see alignment E=1.7e-47

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 99% identity to eca:ECA1461)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>HER17_RS14410 ABC transporter permease (Pectobacterium carotovorum WPP14)
MSQQPLSKSITPSNSRGRFDPIAFFERFGVFIFMILLLIFFQSQNSNFLSERNITNILTE
VSIYGIMAVGMTFVILTAGIDLSVGSILAVCAITAASVIKGDNFTTVDPDAWYGLSWLVA
LGVCLAMGTFIGFLHGLGVTKLRLPPFIVTLGGMTIWRGLTLVMNDGAPIAGFDPGYRWW
GRGEILGISVPIWIFALVALLGYLALHKTRWGRFVYAIGGNTEAARLAGVNVQRVLVSVY
VVIGCLAGLAGFILSARLGSAEAVAGITFELRVIASVVIGGTSLMGGYGRISGTIIGSII
MGILINGLVLMNVSAYYQQIITGLIIVLAVAFDTYAKSRRGAI